PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA06G12810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 289aa    MW: 28990.1 Da    PI: 7.4336
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA06G12810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-382884460
           zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                     ++++cprCds+ntkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+
  ONIVA06G12810.1 28 EEVRCPRCDSSNTKFCYYNNYNLSQPRHFCKACRRYWTKGGLLRNVPVGGGCRKPKR 84
                     6789**************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.2E-332984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0873084IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-233179IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MQEFHPVPGL AGRLFGGAAA AAAVAAVEEV RCPRCDSSNT KFCYYNNYNL SQPRHFCKAC  60
RRYWTKGGLL RNVPVGGGCR KPKRPAPPPS SSFTGGGRGG GGCGHRDSKS ARSAGGGGDD  120
SGSTASATAT PAAAPASSNT LSAAVSQPSS VDALSPPPAP MFADQATAFA SLFAPPPPPP  180
SQALPAFASF TAQPKAEEDV ADAPALAATE QHRSSSAASF AAHSISPPFA AARSSDGPAA  240
AAAAAAADWA PPTAVLDAGM FDLAGAIGGD TSYWNAASWT DHDGTIYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195101GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047910.0AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641761.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A0E0HP410.0A0A0E0HP41_ORYNI; Uncharacterized protein
STRINGLOC_Os06g17410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.13e-29Dof family protein